PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000146390
Common NameWRKY6
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family WRKY
Protein Properties Length: 385aa    MW: 42665.8 Da    PI: 6.3943
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000146390genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY106.51.4e-33194252159
                    ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    ldDgy+WrKYGqK vk+s++prsYYrCt+agC vkk+vers++dp++v++tYeg+H+h+
  MDP0000146390 194 LDDGYRWRKYGQKAVKNSPYPRSYYRCTTAGCGVKKRVERSSDDPSTVVTTYEGQHTHP 252
                    59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.3E-35179254IPR003657WRKY domain
SuperFamilySSF1182905.75E-30186254IPR003657WRKY domain
PROSITE profilePS5081133.315189254IPR003657WRKY domain
SMARTSM007741.1E-40194253IPR003657WRKY domain
PfamPF031062.1E-27195252IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010200Biological Processresponse to chitin
GO:0042742Biological Processdefense response to bacterium
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 385 aa     Download sequence    Send to blast
MDGREEELKT TDRSXSMANS AVFSDEIPTN FPSFSGIFDM PSSCEDQKGS LGGFXDLLXI  60
PDYAPSLFDF PQTTSSLMMI PPHHNQQRSL PAPASTSTVV AMPERESATT TNTTSEVLNS  120
STAPTTPNSS SISSSSNEAA ANNNEGQMXK VQEEEADEQD PEKTQKQLKP KKKNQKRQRE  180
PRFAFMTKSE VDNLDDGYRW RKYGQKAVKN SPYPRSYYRC TTAGCGVKKR VERSSDDPST  240
VVTTYEGQHT HPSPITPRGT MGIAPLPHQS TGFISAAEAS SNPFGVQQFL PHHHHYQQQQ  300
QQQYAYMYQS SPSLNISSST YGGGAGGGPF NPSSFSTSLL QERYNFEGPP SSSATNFLRD  360
HGLLQDIVPQ IRKEPKEEDH HHQHQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A1e-30184254777Probable WRKY transcription factor 4
1wj2_A1e-30184254777Probable WRKY transcription factor 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.159770.0bud| fruit| root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001281064.10.0probable WRKY transcription factor 48
SwissprotQ9FGZ49e-59WRK48_ARATH; Probable WRKY transcription factor 48
TrEMBLD9ZJG10.0D9ZJG1_MALDO; WRKY domain class transcription factor
STRINGVIT_05s0077g00730.t018e-87(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF100234114
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49520.12e-50WRKY DNA-binding protein 48